PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874603.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 234aa    MW: 25283.7 Da    PI: 8.947
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874603.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.11.1e-4147145199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe++r da++slvyeA+ r+rdPvyG++gvi++lq+ql++l+ael+
  XP_015874603.1  47 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLMEVPESQRADAANSLVYEANLRLRDPVYGCMGVISALQHQLQSLQAELN 141
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_015874603.1 142 AIRT 145
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.62446147IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4247144IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MSRDRERLED EIGKKIRGSE ISTVSANSQM GRRISFAPPG TLNTITPCAA CKLLRRRCAE  60
ECPFSPYFSP HEPQKFAAVH KVFGASNVSK LLMEVPESQR ADAANSLVYE ANLRLRDPVY  120
GCMGVISALQ HQLQSLQAEL NAIRTDILKY KYREAATHIV SSSLVSPGVV SIAAPPQAIS  180
PSPPPPRPPP PPPRPPPSVV ISSSSTSSTS SLYTPSTTTT GYSSISSDNV PYFD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874603.11e-169PREDICTED: LOB domain-containing protein 13
SwissprotQ9AT612e-77LBD13_ARATH; LOB domain-containing protein 13
TrEMBLD7SJL69e-98D7SJL6_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g07790.t013e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-71LOB domain-containing protein 15